PDB entry 1r67

View 1r67 on RCSB PDB site
Description: y104a mutant of e.coli ipp isomerase
Deposited on 2003-10-15, released 2003-10-21
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r67a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r67A (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfraratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r67A (A:)
    lafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgvei
    tppesiypdfraratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhgid
    atpwafspwmvmqatnrearkrlsaftqlkl