PDB entry 1r67

View 1r67 on RCSB PDB site
Description: y104a mutant of e.coli ipp isomerase
Class: isomerase
Keywords: complex y104a mutant, isomerase
Deposited on 2003-10-15, released 2003-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-09, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IDI OR B2889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822 (Start-181)
      • engineered (103)
      • cloning artifact (182)
    Domains in SCOPe 2.08: d1r67a1, d1r67a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r67A (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfraratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r67A (A:)
    lafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgvei
    tppesiypdfraratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhgid
    atpwafspwmvmqatnrearkrlsaftqlkl