PDB entry 1r66

View 1r66 on RCSB PDB site
Description: Crystal Structure of DesIV (dTDP-glucose 4,6-dehydratase) from Streptomyces venezuelae with NAD and TYD bound
Class: lyase
Keywords: Dehydratase, Rossmann Fold, Short-Chain Dehydrogenase/Reductase, LYASE
Deposited on 2003-10-14, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TDP-glucose-4,6-dehydratase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: DesIV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZGH3 (0-End)
      • conflict (286)
    Domains in SCOPe 2.08: d1r66a_
  • Heterogens: CL, NAD, TYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r66A (A:)
    mrllvtggagfigshfvrqllagaypdvpadevivldsltyagnranlapvdadprlrfv
    hgdirdagllarelrgvdaivhfaaeshvdrsiagasvftetnvqgtqtllqcavdagvg
    rvvhvstdevygsidsgswtessplepnspyaaskagsdlvarayhrtygldvritrccn
    nygpyqhpekliplfvtnlldggtlplygdganvrewvhtddhcrgialvlaggrageiy
    higggleltnreltgilldslgadwssvrkvadrkghdlrysldggkierelgyrpqvsf
    adglartvrwyrenrgwweplkatapqlpatavevsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r66A (A:)
    mrllvtggagfigshfvrqllagaypdvpadevivldsltyagnranlapvdadprlrfv
    hgdirdagllarelrgvdaivhfaaeshvdrsiagasvftetnvqgtqtllqcavdagvg
    rvvhvstdevygsidsgswtessplepnspyaaskagsdlvarayhrtygldvritrccn
    nygpyqhpekliplfvtnlldggtlplygdganvrewvhtddhcrgialvlaggrageiy
    higggleltnreltgilldslgadwssvrkvadrkghdlrysldggkierelgyrpqvsf
    adglartvrwyrenrgwweplk