PDB entry 1r62

View 1r62 on RCSB PDB site
Description: Crystal structure of the C-terminal Domain of the Two-Component System Transmitter Protein NRII (NtrB)
Class: transferase
Keywords: nrii, pii, histidine kinase, two component system, transferase
Deposited on 2003-10-14, released 2004-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.237
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrogen regulation protein NR(II)
    Species: Escherichia coli [TaxId:83333]
    Gene: NTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r62a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r62A (A:)
lpgtrvtesihkvaervvtlvsmelpdnvrlirdydpslpelahdpdqieqvllnivrna
lqalgpeggeiilrtrtafqltlhgeryrlaaridvedngpgipphlqdtlfypmvsgre
ggtglglsiarnlidqhsgkieftswpghtefsvylpirk

    Sequence, based on observed residues (ATOM records): (download) 
    >1r62A (A:)
rvtesihkvaervvtlvsmelpdnvrlirdydpslpelahdpdqieqvllnivrnalqal
gpeggeiilrtrtafqltlhgeryrlaaridvedngpgiglglsiarnlidqhsgkieft
swpghtefsvylpirk