PDB entry 1r5w

View 1r5w on RCSB PDB site
Description: Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T-cell activation
Class: signaling protein
Keywords: TCR, MHC class II, structural rearangement, SIGNALING PROTEIN
Deposited on 2003-10-13, released 2004-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.289
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r5wa1, d1r5wa2
  • Chain 'B':
    Compound: MHC H2-IE-beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q31164 (1-184)
      • cloning artifact (0)
      • engineered (7)
    Domains in SCOPe 2.06: d1r5wb1, d1r5wb2, d1r5wb3
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r5wc1, d1r5wc2
  • Chain 'D':
    Compound: MHC H2-IE-beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q31164 (1-184)
      • cloning artifact (0)
      • engineered (7)
    Domains in SCOPe 2.06: d1r5wd1, d1r5wd2, d1r5wd3
  • Chain 'E':
    Compound: artificial peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R5W (0-12)
  • Chain 'F':
    Compound: artificial peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R5W (0-12)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5wA (A:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5wB (B:)
    apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
    qpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdfy
    pgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5wC (C:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5wD (D:)
    apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
    qpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdfy
    pgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvew
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.