PDB entry 1r5v

View 1r5v on RCSB PDB site
Description: Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T-cell activation
Class: signaling protein
Keywords: TCR, MHC class II, structural rearangement, SIGNALING PROTEIN
Deposited on 2003-10-13, released 2004-02-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r5va1, d1r5va2
  • Chain 'B':
    Compound: MHC H2-IE-beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18468 (1-184)
      • cloning artifact (0)
      • engineered (7)
    Domains in SCOPe 2.03: d1r5vb1, d1r5vb2
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r5vc1, d1r5vc2
  • Chain 'D':
    Compound: MHC H2-IE-beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18468 (1-184)
      • cloning artifact (0)
      • engineered (7)
    Domains in SCOPe 2.03: d1r5vd1, d1r5vd2
  • Chain 'E':
    Compound: artificial peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R5V (0-12)
  • Chain 'F':
    Compound: artificial peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R5V (0-12)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vA (A:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vB (B:)
    apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
    qpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdfy
    pgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vC (C:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vD (D:)
    apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
    qpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdfy
    pgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvew
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.