PDB entry 1r5t

View 1r5t on RCSB PDB site
Description: the crystal structure of cytidine deaminase cdd1, an orphan c to u editase from yeast
Deposited on 2003-10-13, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r5ta_
  • Chain 'B':
    Domains in SCOP 1.69: d1r5tb_
  • Chain 'C':
    Domains in SCOP 1.69: d1r5tc_
  • Chain 'D':
    Domains in SCOP 1.69: d1r5td_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5tA (A:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tA (A:)
    kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
    aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
    rskvmtmgellpmafgpshln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r5tB (B:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tB (B:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r5tC (C:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tC (C:)
    kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
    aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
    rskvmtmgellpmafgpshl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r5tD (D:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tD (D:)
    vggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncica
    ersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgsr
    skvmtmgellpmaf