PDB entry 1r5t

View 1r5t on RCSB PDB site
Description: The Crystal Structure of Cytidine Deaminase CDD1, an Orphan C to U editase from Yeast
Class: hydrolase
Keywords: Zinc Dependent Deaminase, RNA editing, APOBEC-1 related protein, HYDROLASE
Deposited on 2003-10-13, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Cdd1p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r5ta_
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Cdd1p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r5tb_
  • Chain 'C':
    Compound: Cytidine deaminase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Cdd1p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r5tc_
  • Chain 'D':
    Compound: Cytidine deaminase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Cdd1p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r5td_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5tA (A:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tA (A:)
    kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
    aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
    rskvmtmgellpmafgpshln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r5tB (B:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tB (B:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r5tC (C:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tC (C:)
    kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
    aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
    rskvmtmgellpmafgpshl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r5tD (D:)
    mkvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysnci
    caersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstg
    srskvmtmgellpmafgpshln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5tD (D:)
    vggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncica
    ersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgsr
    skvmtmgellpmaf