PDB entry 1r5s

View 1r5s on RCSB PDB site
Description: Connexin 43 Carboxyl Terminal Domain
Class: membrane protein
Keywords: Cx43CT, MEMBRANE PROTEIN
Deposited on 2003-10-13, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gap junction alpha-1 protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GJA1 OR CXN-43
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08050 (4-131)
      • linker (0-3)
    Domains in SCOPe 2.07: d1r5sa1, d1r5sa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5sA (A:)
    gplgspskdcgspkyayfngcssptaplspmsppgyklvtgdrnnsscrnynkqaseqnw
    anysaeqnrmgqagstisnshaqpfdfpddnqnakkvaaghelqplaivdqrpssrassr
    assrprpddlei