PDB entry 1r5q

View 1r5q on RCSB PDB site
Description: Crystal Structure Analysis of Kai A from PCC7120
Class: gene regulation
Keywords: four-helix-bundle, gene regulation
Deposited on 2003-10-12, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: circadian oscillation regulator
    Species: Nostoc sp. [TaxId:103690]
    Gene: Kai A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r5qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5qA (A:)
    mtqevdqqillqqlksdyrqillsyfttdkalkekidkfinavfcanipvpeiieihmel
    idefskqlrlegrgdetlmdyrltlidilahlceayrgaifk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5qA (A:)
    evdqqillqqlksdyrqillsyfttdlkekidkfinavfcanipvpeiieihmelidefs
    kqlrlgdlmdyrltlidilahlceayrgaif