PDB entry 1r5p

View 1r5p on RCSB PDB site
Description: Crystal Structure Analysis of KaiB from PCC7120
Deposited on 2003-10-12, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r5pa_
  • Chain 'B':
    Domains in SCOP 1.67: d1r5pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5pA (A:)
    mnkarktyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkil
    atptlskilpppvrkiigdlsdrervligldllyeelteedweaqsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5pA (A:)
    tyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkilatptls
    kilpppvrkiigdlsdrervligldllyee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r5pB (B:)
    mnkarktyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkil
    atptlskilpppvrkiigdlsdrervligldllyeelteedweaqsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5pB (B:)
    ktyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkilatptl
    skilpppvrkiigdlsdrervligldllyeelt