PDB entry 1r5l

View 1r5l on RCSB PDB site
Description: Crystal Structure of Human Alpha-Tocopherol Transfer Protein Bound to its Ligand
Class: transport protein
Keywords: attp, tocopherol, ataxia with vitamin e deficiency, transport protein
Deposited on 2003-10-10, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Alpha-tocopherol transfer protein)
    Species: Homo sapiens [TaxId:9606]
    Gene: TTPA OR TPP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49638
      • modified residue (192)
      • modified residue (207)
      • modified residue (235)
      • modified residue (247)
    Domains in SCOPe 2.08: d1r5la1, d1r5la2
  • Heterogens: VIV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5lA (A:)
    gshmspllqpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykw
    raecpeisadlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvs
    litselivqevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihl
    inepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedic
    qewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5lA (A:)
    qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
    adlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitseliv
    qevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifh
    avfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfim
    ksedylssise