PDB entry 1r5j

View 1r5j on RCSB PDB site
Description: Crystal Structure of a Phosphotransacetylase from Streptococcus pyogenes
Deposited on 2003-10-10, released 2004-04-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r5ja_
  • Chain 'B':
    Domains in SCOP 1.69: d1r5jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5jA (A:)
    ggggggmsirslfgglrekilgknmkivfpegndervvraaarlkfegllepiilgqsee
    vrnlltklgfadqdytiinpneyadfdkmkeafvevrkgkatledadkmlrdvnyfgvml
    vkmgladgmvsgaihstadtvrpalqiiktkpgisrtsgvflmnrentseryvfadcain
    idptaqelaeiavntaetakifdidpkiamlsfstkgsgkapqvdkvreateiatglnpd
    laldgelqfdaafvpetaaikapdsavagqantfvfpdlqsgnigykiaqrlgmfdaigp
    ilqglnkpvndlsrgssaediyklaiitaaqaiesqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5jA (A:)
    msirslfgglrekilgknmkivfpegndervvraaarlkfegllepiilgqseevrnllt
    klgfadqdytiinpneyadfdkmkeafvevrkgkatledadkmlrdvnyfgvmlvkmgla
    dgmvsgaihstadtvrpalqiiktkpgisrtsgvflmnrentseryvfadcainidptaq
    elaeiavntaetakifdidpkiamlsfstkgsgkapqvdkvreateiatglnpdlaldge
    lqfdaafvpetaaikapdsavagqantfvfpdlqsgnigykiaqrlgmfdaigpilqgln
    kpvndlsrgssaediyklaiitaaqaies
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r5jB (B:)
    ggggggmsirslfgglrekilgknmkivfpegndervvraaarlkfegllepiilgqsee
    vrnlltklgfadqdytiinpneyadfdkmkeafvevrkgkatledadkmlrdvnyfgvml
    vkmgladgmvsgaihstadtvrpalqiiktkpgisrtsgvflmnrentseryvfadcain
    idptaqelaeiavntaetakifdidpkiamlsfstkgsgkapqvdkvreateiatglnpd
    laldgelqfdaafvpetaaikapdsavagqantfvfpdlqsgnigykiaqrlgmfdaigp
    ilqglnkpvndlsrgssaediyklaiitaaqaiesqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5jB (B:)
    msirslfgglrekilgknmkivfpegndervvraaarlkfegllepiilgqseevrnllt
    klgfadqdytiinpneyadfdkmkeafvevrkgkatledadkmlrdvnyfgvmlvkmgla
    dgmvsgaihstadtvrpalqiiktkpgisrtsgvflmnrentseryvfadcainidptaq
    elaeiavntaetakifdidpkiamlsfstkgsgkapqvdkvreateiatglnpdlaldge
    lqfdaafvpetaaikapdsavagqantfvfpdlqsgnigykiaqrlgmfdaigpilqgln
    kpvndlsrgssaediyklaiitaaqaies