PDB entry 1r5e

View 1r5e on RCSB PDB site
Description: Solution structure of the folded core of Pseudomonas syringae effector protein, AvrPto
Deposited on 2003-10-10, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1r5ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5eA (A:)
    mdnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqh
    rymtgasginpgmlphenvddmrsaitdwsdmrealqhamgihadivdykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5eA (A:)
    dnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqhr
    ymtgasginpgmlphenvddmrsaitdwsdmrealqhamgihadi