PDB entry 1r5b

View 1r5b on RCSB PDB site
Description: Crystal structure analysis of sup35
Class: translation
Keywords: translation termination, peptide release, gtpase, translation
Deposited on 2003-10-10, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.256
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic peptide chain release factor GTP-binding subunit
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SUP35, SPCC584.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r5ba1, d1r5ba2, d1r5ba3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5bA (A:)
    sapaaalkkaaeaaepatvtedatdlqnevdqellkdmygkehvnivfighvdagkstlg
    gnilfltgmvdkrtmekiereakeagkeswylswaldstseerekgktvevgrayfeteh
    rrfslldapghkgyvtnmingasqadigvlvisarrgefeagferggqtrehavlartqg
    inhlvvvinkmdepsvqwseerykecvdklsmflrrvagynsktdvkympvsaytgqnvk
    drvdssvcpwyqgpslleyldsmthlerkvnapfimpiaskykdlgtilegkieagsikk
    nsnvlvmpinqtlevtaiydeadeeisssicgdqvrlrvrgddsdvqtgyvltstknpvh
    attrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfatk
    gmkiiaeletqtpvcmerfedyqymgrftlrdqgttvavgkvvkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5bA (A:)
    tedatdlqnevdqellkdmygkehvnivfighvdagkstlggnilfltgmvdkrtmekie
    reakerayfetehrrfslldapgasqadigvlvisarrgefeagferggqtrehavlart
    qginhlvvvinkmdepsvqwseerykecvdklsmflrrvagynsktdvkympvsaytgqn
    vkdrvdssvcpwyqgpslleyldsmthlerkvnapfimpiaskykdlgtilegkieagsi
    kknsnvlvmpinqtlevtaiydeadeeisssicgdqvrlrvrgddsdvqtgyvltstknp
    vhattrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfa
    tkgmkiiaeletqtpvcmerfedyqymgrftlrdqgttvavgkvvkild