PDB entry 1r5a

View 1r5a on RCSB PDB site
Description: Glutathione S-transferase
Class: transferase
Keywords: Glutathione S-transferase, GST, Glutathione, GSH, MOSQUITO, DETOXIFICATION, XENOBIOTICS
Deposited on 2003-10-09, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase
    Species: Anopheles cracens [TaxId:123217]
    Gene: adGST1-5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r5aa1, d1r5aa2
  • Heterogens: CU, GTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5aA (A:)
    mttvlyylpasppcrsvlllakmigveldlkvlnimegeqlkpdfvelnpqhciptmddh
    glvlwesrvilsylvsaygkdenlypkdfrsraivdqrlhfdlgtlyqrvvdyyfptihl
    gahldqtkkaklaealgwfeamlkqyqwsaanhftiadialcvtvsqieafqfdlhpypr
    vrawllkckdeleghgykeinetgaetlaglfrsklkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5aA (A:)
    ttvlyylpasppcrsvlllakmigveldlkvlnimegeqlkpdfvelnpqhciptmddhg
    lvlwesrvilsylvsaygkdenlypkdfrsraivdqrlhfdlgtlyqrvvdyyfptihlg
    ahldqtkkaklaealgwfeamlkqyqwsaanhftiadialcvtvsqieafqfdlhpyprv
    rawllkckdeleghgykeinetgaetlaglfrsk