PDB entry 1r59

View 1r59 on RCSB PDB site
Description: Enterococcus casseliflavus glycerol kinase
Class: transferase
Keywords: transferase
Deposited on 2003-10-09, released 2004-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glycerol kinase
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r59o1, d1r59o2
  • Chain 'X':
    Compound: glycerol kinase
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r59x1, d1r59x2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1r59O (O:)
    aeknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvi
    agafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdgh
    temihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhv
    tdysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpia
    gmagdqqaalfgqmafekgmikntygtgafivmntgeepqlsdndllttigygingkvyy
    alegsifvagsaiqwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdsea
    rgavfgltrgttkedfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmq
    fqadildidvqraanlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerd
    nlyegwkqavaatqtfkfkakkege
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r59O (O:)
    nyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviaga
    fiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtem
    ihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdy
    snasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsvpiagmagdqqaal
    fgqmafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvag
    saiqwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrg
    ttkedfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidv
    qraanlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1r59X (X:)
    aeknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvi
    agafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdgh
    temihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhv
    tdysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpia
    gmagdqqaalfgqmafekgmikntygtgafivmntgeepqlsdndllttigygingkvyy
    alegsifvagsaiqwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdsea
    rgavfgltrgttkedfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmq
    fqadildidvqraanlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerd
    nlyegwkqavaatqtfkfkakkege
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r59X (X:)
    nyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviaga
    fiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtem
    ihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdy
    snasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsvpiagmagdqqaal
    fgqmafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvag
    saiqwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrg
    ttkedfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidv
    qraanlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav