PDB entry 1r57

View 1r57 on RCSB PDB site
Description: NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus. Northeast Structural Genomics Consortium Target ZR31
Class: transferase
Keywords: GCN5, N-acetyltransferase, Structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2003-10-09, released 2004-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SA2309 or MW2441 or SAV2521
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99RB4 (0-93)
      • see remark 999 (56)
      • see remark 999 (67)
      • expression tag (94-101)
    Domains in SCOPe 2.06: d1r57a1, d1r57a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r57A (A:)
    msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
    veharennlkiiascsfakhmlekedsyqdvylglehhhhhh