PDB entry 1r57

View 1r57 on RCSB PDB site
Description: nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31
Deposited on 2003-10-09, released 2004-03-09
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1r57a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r57A (A:)
  msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
  veharennlkiiascsfakhmlekedsyqdvylglehhhhhh