PDB entry 1r56

View 1r56 on RCSB PDB site
Description: uncomplexed urate oxidase from aspergillus flavus
Deposited on 2003-10-09, released 2004-03-02
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r56A (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56A (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r56B (B:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56B (B:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r56C (C:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56C (C:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r56D (D:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56D (D:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r56E (E:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56E (E:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r56F (F:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56F (F:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r56G (G:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56G (G:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r56H (H:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r56H (H:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs