PDB entry 1r54

View 1r54 on RCSB PDB site
Description: Crystal structure of the catalytic domain of human ADAM33
Class: hydrolase
Keywords: metalloprotease, asthma, ADAM, HYDROLASE
Deposited on 2003-10-09, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adam 33
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZ11 (0-205)
      • engineered (27)
    Domains in SCOPe 2.07: d1r54a_
  • Heterogens: NAG, ZN, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r54A (A:)
    earrtrkylelyivadhtlfltrhrnlqhtkqrllevanyvdqllrtldiqvaltglevw
    terdrsrvtqdanatlwaflqwrrglwaqrphdsaqlltgrafqgatvglapvegmcrae
    ssggvstdhselpigaaatmaheighslglshdpdgccveaaaesggcvmaaatghpfpr
    vfsacsrrqlraffrkgggaclsnapsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r54A (A:)
    earrtrkylelyivadhtlfltrhrnlqhtkqrllevanyvdqllrtldiqvaltglevw
    terdrsrvtqdanatlwaflqwrrglwaqrphdsaqlltgrafqgatvglapvegmcrae
    ssggvstdhselpigaaatmaheighslglshdpdgccveaaaesggcvmaaatghpfpr
    vfsacsrrqlraffrkgggaclsnap