PDB entry 1r50

View 1r50 on RCSB PDB site
Description: Bacillus subtilis lipase A with covalently bound Sc-IPG-phosphonate-inhibitor
Class: Hydrolase
Keywords: lipase, alpha/beta hydrolase, phosphonate inhibitor
Deposited on 2003-10-09, released 2004-10-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.196
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Bacillus subtilis
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r50a_
  • Chain 'B':
    Compound: Lipase
    Species: Bacillus subtilis
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r50b_
  • Heterogens: SIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r50A (A:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r50A (A:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r50B (B:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r50B (B:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn