PDB entry 1r4z

View 1r4z on RCSB PDB site
Description: Bacillus subtilis lipase A with covalently bound Rc-IPG-phosphonate-inhibitor
Class: Hydrolase
Keywords: lipase, ALPHA/BETA HYDROLASE, phosphonate inhibitor
Deposited on 2003-10-09, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r4za_
  • Chain 'B':
    Compound: Lipase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r4zb_
  • Heterogens: RIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4zA (A:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4zA (A:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r4zB (B:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4zB (B:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn