PDB entry 1r4z

View 1r4z on RCSB PDB site
Description: Bacillus subtilis lipase A with covalently bound Rc-IPG-phosphonate-inhibitor
Deposited on 2003-10-09, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1r4za_
  • Chain 'B':
    Domains in SCOP 1.71: d1r4zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4zA (A:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4zA (A:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r4zB (B:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpn
    qkilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4zB (B:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn