PDB entry 1r4x

View 1r4x on RCSB PDB site
Description: Crystal Structure Analys of the Gamma-COPI Appendage domain
Deposited on 2003-10-09, released 2003-10-28
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4xA (A:)
    mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm
    vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta
    vactfscmmkftvkdcdpttgetddegyedeyvledlevtvadhiqkvmklnfeaawdev
    gdefekeetftlstiktleeavgnivkflgmhpcersdkvpdnknthtlllagvfrgghd
    ilvrsrlllldtvtmqvtarsleelpvdiilasvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4xA (A:)
    mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm
    vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta
    vactfscmmkftvkdcdpttgetddegyedeyvledlevtvadhiqkvmklnfeaawdev
    gdefekeetftlstiktleeavgnivkflgmhpcersdkvpdnknthtlllagvfrgghd
    ilvrsrlllldtvtmqvtarsleelpvdiilasv