PDB entry 1r4x

View 1r4x on RCSB PDB site
Description: Crystal Structure Analys of the Gamma-COPI Appendage domain
Class: protein transport
Keywords: Appendage; Beta Sandwich; COATOMER; ADP-RIBOSYLATION FACTORS, PROTEIN TRANSPORT
Deposited on 2003-10-09, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coatomer gamma subunit
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y678 (8-End)
      • expression tag (0-7)
      • modified residue (91)
    Domains in SCOPe 2.07: d1r4xa1, d1r4xa2, d1r4xa3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4xA (A:)
    mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm
    vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta
    vactfscmmkftvkdcdpttgetddegyedeyvledlevtvadhiqkvmklnfeaawdev
    gdefekeetftlstiktleeavgnivkflgmhpcersdkvpdnknthtlllagvfrgghd
    ilvrsrlllldtvtmqvtarsleelpvdiilasvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4xA (A:)
    mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm
    vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta
    vactfscmmkftvkdcdpttgetddegyedeyvledlevtvadhiqkvmklnfeaawdev
    gdefekeetftlstiktleeavgnivkflgmhpcersdkvpdnknthtlllagvfrgghd
    ilvrsrlllldtvtmqvtarsleelpvdiilasv