PDB entry 1r4v

View 1r4v on RCSB PDB site
Description: 1.9A crystal structure of protein AQ328 from Aquifex aeolicus
Class: Structural genomics, unknown function
Keywords: structural genomics, all-alpha, histon fold, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-10-08, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AQ_328
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: AQ_328
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66665 (Start-170)
      • modified residue (22)
      • modified residue (103)
      • modified residue (120)
      • modified residue (134)
      • modified residue (140)
      • modified residue (159)
    Domains in SCOPe 2.07: d1r4va_
  • Heterogens: ZN, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4vA (A:)
    mqekynfgkvssqhknyskietmlrpkgfdkldhyfrteldidltdetielllnsvkaaf
    gklfygaeqrarwngrdfialadlnitkaleehiknfqkieqdmgvdelleyiafippve
    mnvgedlkseyrnimgglllmhadvikkatgerkpsreamefvaqivdkvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4vA (A:)
    etmlrpkgfdkldhyfrteldidltdetielllnsvkaafgklfygaeqrarwngrdfia
    ladlnitkaleehiknfqkieqdmgvdelleyiafippvemnvgedlkseyrnimgglll
    mhadvikkatgerkpsreamefvaqivdkvf