PDB entry 1r4u

View 1r4u on RCSB PDB site
Description: urate oxidase from aspergillus flavus complexed with its inhibitor oxonic acid
Class: oxidoreductase
Keywords: oxidoreductase, uric acid degradation, dimeric barrel, tunnel-shaped protein
Deposited on 2003-10-08, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.08: d1r4ua1, d1r4ua2
  • Heterogens: OXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4uA (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4uA (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs