PDB entry 1r4p

View 1r4p on RCSB PDB site
Description: shiga toxin type 2
Deposited on 2003-10-07, released 2004-05-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.151
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r4pa_
  • Chain 'B':
    Domains in SCOP 1.67: d1r4pb_
  • Chain 'C':
    Domains in SCOP 1.67: d1r4pc_
  • Chain 'D':
    Domains in SCOP 1.67: d1r4pd_
  • Chain 'E':
    Domains in SCOP 1.67: d1r4pe_
  • Chain 'F':
    Domains in SCOP 1.67: d1r4pf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4pA (A:)
    reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
    qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
    aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
    alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
    chhqgarsvravneesqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4pA (A:)
    reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
    qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
    aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
    alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
    checqitgdrpvikinntlwesntaaaflnrksqflyttgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4pB (B:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4pC (C:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4pD (D:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4pE (E:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4pF (F:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd