PDB entry 1r4n

View 1r4n on RCSB PDB site
Description: APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex with ATP
Class: cell cycle
Keywords: cell cycle
Deposited on 2003-10-07, released 2003-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.251
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta precursor protein-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4na_
  • Chain 'B':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC4 (0-End)
      • engineered (138)
    Domains in SCOPe 2.03: d1r4nb_
  • Chain 'C':
    Compound: amyloid beta precursor protein-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4nc_
  • Chain 'D':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC4 (0-End)
      • engineered (138)
    Domains in SCOPe 2.03: d1r4nd_
  • Chain 'E':
    Compound: amyloid beta precursor protein-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4ne_
  • Chain 'F':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC4 (0-End)
      • engineered (138)
    Domains in SCOPe 2.03: d1r4nf_
  • Chain 'G':
    Compound: amyloid beta precursor protein-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4ng_
  • Chain 'H':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC4 (0-End)
      • engineered (138)
    Domains in SCOPe 2.03: d1r4nh_
  • Chain 'I':
    Compound: Ubiquitin-like protein NEDD8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4ni_
  • Chain 'J':
    Compound: Ubiquitin-like protein NEDD8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4nj_
  • Chain 'K':
    Compound: Ubiquitin-like protein NEDD8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4nk_
  • Chain 'L':
    Compound: Ubiquitin-like protein NEDD8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1r4nl_
  • Heterogens: ZN, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4nA (A:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
    ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
    qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
    ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
    gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nA (A:)
    kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
    sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
    vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
    dkpfpelrehfqsydhshtpwiviiakylaqwysetngripktykekedfrdlirqgilk
    pedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefvake
    gqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesisek
    elkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfhkq
    qgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaflg
    gaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r4nB (B:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
    qtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nB (B:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatnrtlylqsvtsieertrkelglvdgqeavadvttpqtvlfklhft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r4nC (C:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
    ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
    qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
    ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
    gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nC (C:)
    kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
    sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
    vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
    dkpfpelrehfqsydhshtpwiviiakylaqwysetngripktykekedfrdlirqgilk
    pedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefvake
    gqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesisek
    elkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfhkq
    qgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaflg
    gaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r4nD (D:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
    qtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nD (D:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatnrtlylqsvtsieertrkelglvdgqeavadvttpqtvlfklhft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r4nE (E:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
    ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
    qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
    ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
    gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nE (E:)
    kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
    sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
    vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
    dkpfpelrehfqsydhshtpwiviiakylaqwysetngripktykekedfrdlirqgilk
    pedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefvake
    gqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesisek
    elkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfhkq
    qgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaflg
    gaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r4nF (F:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
    qtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nF (F:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatnrtlylqsvtsieertrkelglvdgqeavadvttpqtvlfklhft
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r4nG (G:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
    ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
    qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
    ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
    gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nG (G:)
    kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
    sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
    vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
    dkpfpelrehfqsydhshtpwiviiakylaqwysetngripktykekedfrdlirqgilk
    pedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefvake
    gqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesisek
    elkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfhkq
    qgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaflg
    gaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r4nH (H:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
    qtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4nH (H:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
    aslqmkspaitatnrtlylqsvtsieertrkelglvdgqeavadvttpqtvlfklhft
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4nI (I:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4nJ (J:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4nK (K:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4nL (L:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg