PDB entry 1r4k

View 1r4k on RCSB PDB site
Description: Solution Structure of the Drosophila Argonaute 1 PAZ Domain
Class: RNA binding protein
Keywords: beta barrel, RNA BINDING PROTEIN
Deposited on 2003-10-07, released 2003-12-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute 1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ago1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4kA (A:)
    gtafykaqpvidfmcevldirdineqrkpltdsqrvkftkeikglkieithcgqmrrkyr
    vcnvtrrpaqmqsfplqlengqtvectvakyfldkyrmklryphlpclqvgqehkhtylp
    levcnivagqrcikkltdmqtstmikatarsapdrereinnlvkradfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4kA (A:)
    tafykaqpvidfmcevldirdineqrkpltdsqrvkftkeikglkieithcgqmrrkyrv
    cnvtrrpaqmqsfplqlengqtvectvakyfldkyrmklryphlpclqvgqehkhtylpl
    evcnivagqrcikkltdmqtstmikatarsapdrereinnlvkradfn