PDB entry 1r4k

View 1r4k on RCSB PDB site
Description: solution structure of the drosophila argonaute 1 paz domain
Deposited on 2003-10-07, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r4ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4kA (A:)
    gtafykaqpvidfmcevldirdineqrkpltdsqrvkftkeikglkieithcgqmrrkyr
    vcnvtrrpaqmqsfplqlengqtvectvakyfldkyrmklryphlpclqvgqehkhtylp
    levcnivagqrcikkltdmqtstmikatarsapdrereinnlvkradfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4kA (A:)
    tafykaqpvidfmcevldirdineqrkpltdsqrvkftkeikglkieithcgqmrrkyrv
    cnvtrrpaqmqsfplqlengqtvectvakyfldkyrmklryphlpclqvgqehkhtylpl
    evcnivagqrcikkltdmqtstmikatarsapdrereinnlvkradfn