PDB entry 1r4g

View 1r4g on RCSB PDB site
Description: solution structure of the sendai virus protein x c-subdomain
Deposited on 2003-10-06, released 2004-03-09
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r4ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4gA (A:)
    kptmhslrlviessplsraekaayvkslskcktdqevkavmelveediesltn