PDB entry 1r4f

View 1r4f on RCSB PDB site
Description: Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma vivax: Trp260Ala Mutant In Complex With 3-Deaza-Adenosine
Class: hydrolase
Keywords: Rossmann fold, aromatic stacking, HYDROLASE
Deposited on 2003-10-06, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IAG-nucleoside hydrolase
    Species: Trypanosoma vivax [TaxId:5699]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GPQ4 (13-338)
      • expression tag (12)
      • engineered (270)
      • see remark 999 (225)
    Domains in SCOPe 2.07: d1r4fa1, d1r4fa2
  • Chain 'B':
    Compound: IAG-nucleoside hydrolase
    Species: Trypanosoma vivax [TaxId:5699]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GPQ4 (13-338)
      • expression tag (12)
      • engineered (270)
      • see remark 999 (225)
    Domains in SCOPe 2.07: d1r4fb1, d1r4fb2
  • Heterogens: CA, AD3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4fA (A:)
    mrgsphhhhhhgsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfn
    vtgkimclmhnnmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdki
    kaenekyegqqlladlvmnseekvticvtgplsnvawcidkygekftskveecvimggav
    dvrgnvflpstdgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfge
    qtnfllsilvgtmwamcthcellrdgdgyyaadaltaayvvdqkvanvdpvpidvvvdkq
    pnegatvrtdaenypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4fA (A:)
    saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
    mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
    ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
    gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
    mwamyaadaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpea
    effldmllrsarac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r4fB (B:)
    mrgsphhhhhhgsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfn
    vtgkimclmhnnmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdki
    kaenekyegqqlladlvmnseekvticvtgplsnvawcidkygekftskveecvimggav
    dvrgnvflpstdgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfge
    qtnfllsilvgtmwamcthcellrdgdgyyaadaltaayvvdqkvanvdpvpidvvvdkq
    pnegatvrtdaenypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4fB (B:)
    saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
    mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
    ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
    gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
    mwamyaadaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpea
    effldmllrsarac