PDB entry 1r4c

View 1r4c on RCSB PDB site
Description: N-Truncated Human Cystatin C; Dimeric Form With 3D Domain Swapping
Class: hydrolase inhibitor
Keywords: human cystatin c, n-truncation, 3d domain swapping, amyloid formation, inhibitor of c1 and c13 cysteine proteases, amyloid angiopathy and cerebral hemorrhage, hydrolase inhibitor
Deposited on 2003-10-06, released 2004-09-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4ca_
  • Chain 'B':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4cb_
  • Chain 'C':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4cc_
  • Chain 'D':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4cd_
  • Chain 'E':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4ce_
  • Chain 'F':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4cf_
  • Chain 'G':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4cg_
  • Chain 'H':
    Compound: Cystatin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r4ch_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cA (A:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cB (B:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cC (C:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cD (D:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cE (E:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cF (F:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cG (G:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4cH (H:)
    ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
    ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda