PDB entry 1r4a

View 1r4a on RCSB PDB site
Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX
Class: protein transport
Keywords: Ras-like G Protein structure, Three-helix GRIP domain, PROTEIN TRANSPORT
Deposited on 2003-10-04, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.251
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4aa_
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4ab_
  • Chain 'C':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4ac_
  • Chain 'D':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4ad_
  • Chain 'E':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: GOLGIN-245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4ae_
  • Chain 'F':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: GOLGIN-245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4af_
  • Chain 'G':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: GOLGIN-245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4ag_
  • Chain 'H':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: GOLGIN-245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r4ah_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aA (A:)
    remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
    pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
    psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aB (B:)
    remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
    pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
    psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aC (C:)
    remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
    pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
    psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aD (D:)
    remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
    pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
    psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aE (E:)
    ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aF (F:)
    ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aG (G:)
    ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r4aH (H:)
    ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf