PDB entry 1r49

View 1r49 on RCSB PDB site
Description: Human topoisomerase I (Topo70) double mutant K532R/Y723F
Class: Isomerase/DNA
Keywords: Protein, DNA, topoisomerase I, Isomerase/DNA COMPLEX
Deposited on 2003-10-03, released 2003-12-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: 0.28
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-591)
      • engineered (358)
      • engineered (549)
    Domains in SCOPe 2.03: d1r49a1, d1r49a2, d1r49a3
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*tp*ap*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(p*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*tp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r49A (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgrd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r49A (A:)
    kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
    kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
    eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
    iiincsdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgrdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravailcnhqmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavq
    rleeqlmklevqatdreenkqsklnfldpritvawckkwgvpiekiynktqrekfawaid
    madedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.