PDB entry 1r49

View 1r49 on RCSB PDB site
Description: human topoisomerase i (topo70) double mutant k532r/y723f
Deposited on 2003-10-03, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: 0.28
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r49A (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgrd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r49A (A:)
    kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
    kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
    eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
    iiincsdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgrdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravailcnhqmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavq
    rleeqlmklevqatdreenkqsklnfldpritvawckkwgvpiekiynktqrekfawaid
    madedyef