PDB entry 1r43

View 1r43 on RCSB PDB site
Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri (selenomethionine substituted protein)
Deposited on 2003-10-03, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r43A (A:)
    mskdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefg
    mrrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpe
    agkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsl
    eeayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkai
    givtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgi
    idakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlq
    vspavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdgls
    hnyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r43A (A:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r43B (B:)
    mskdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefg
    mrrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpe
    agkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsl
    eeayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkai
    givtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgi
    idakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlq
    vspavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdgls
    hnyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r43B (B:)
    aaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftneces
    lgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkdn
    nyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslkn
    igyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgaha
    gttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfrh
    psddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaqf
    kkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqai
    inydnyrvirgh