PDB entry 1r3u

View 1r3u on RCSB PDB site
Description: Crystal Structure of Hypoxanthine-Guanine Phosphoribosyltransferase from Thermoanaerobacter tengcongensis
Class: transferase
Keywords: crystal structure, phosphoribosyltransferase, Thermoanaerobacter tengcongensis, purine salvage
Deposited on 2003-10-03, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Gene: TTE2394
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R7L0
      • engineered (76)
      • engineered (90)
    Domains in SCOPe 2.08: d1r3ua_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Gene: TTE2394
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R7L0
      • engineered (76)
      • engineered (90)
    Domains in SCOPe 2.08: d1r3ub_
  • Heterogens: MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r3uA (A:)
    masmtggqqmgrgsstslykkaglmpspmedieeiliteeqlkakvkelgemitrdyegk
    dlvligvlkgaimfmsglsraidlplsidflavssygsstkssgivkiikdhdidiegkd
    vlivediidsgltlaylretllgrkprslkictildkperreadvkvdycgfkipdkfvv
    gygldyaekyrnlpfigvlkpelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3uA (A:)
    pspmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlp
    lsidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrk
    prslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r3uB (B:)
    masmtggqqmgrgsstslykkaglmpspmedieeiliteeqlkakvkelgemitrdyegk
    dlvligvlkgaimfmsglsraidlplsidflavssygsstkssgivkiikdhdidiegkd
    vlivediidsgltlaylretllgrkprslkictildkperreadvkvdycgfkipdkfvv
    gygldyaekyrnlpfigvlkpelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3uB (B:)
    spmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpl
    sidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkp
    rslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely