PDB entry 1r3n

View 1r3n on RCSB PDB site
Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri
Class: hydrolase
Keywords: alpha and beta protein, di-zinc center, HYDROLASE
Deposited on 2003-10-02, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3na1, d1r3na2
  • Chain 'B':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3nb1, d1r3nb2
  • Chain 'C':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3nc1, d1r3nc2
  • Chain 'D':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3nd1, d1r3nd2
  • Chain 'E':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3ne1, d1r3ne2
  • Chain 'F':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3nf1, d1r3nf2
  • Chain 'G':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3ng1, d1r3ng2
  • Chain 'H':
    Compound: beta-alanine synthase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: PYD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r3nh1, d1r3nh2
  • Heterogens: ZN, BIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r3nA (A:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nA (A:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r3nB (B:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nB (B:)
    paaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftnece
    slgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkd
    nnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslk
    nigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgah
    agttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfr
    hpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaq
    fkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqa
    iinydnyrvirgh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r3nC (C:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nC (C:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r3nD (D:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nD (D:)
    tlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwft
    neceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlr
    tfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvy
    dslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhg
    vgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsft
    ldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrs
    afaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkv
    llqaiinydnyrvirgh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r3nE (E:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nE (E:)
    paaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftnece
    slgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkd
    nnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslk
    nigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgah
    agttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfr
    hpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaq
    fkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqa
    iinydnyrvirgh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r3nF (F:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nF (F:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r3nG (G:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nG (G:)
    aplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftneceslg
    ckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkdnny
    vpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslknig
    yigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgahagt
    tpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfrhps
    ddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaqfkk
    dqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqaiin
    ydnyrvirgh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r3nH (H:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nH (H:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh