PDB entry 1r3l

View 1r3l on RCSB PDB site
Description: potassium channel KcsA-Fab complex in Cs+
Class: membrane protein
Keywords: membrane protein, potassium channel, KcsA-Fab complex, Cesium
Deposited on 2003-10-02, released 2003-11-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1r3la1, d1r3la2
  • Chain 'B':
    Compound: antibody fab fragment heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1r3lb1, d1r3lb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans
    Gene: KCSA, SKC1, SCO7660, SC10F4.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOP 1.73: d1r3lc_
  • Heterogens: CS, DGA, F09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r3lA (A:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r3lB (B:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r3lC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3lC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh