PDB entry 1r3j

View 1r3j on RCSB PDB site
Description: potassium channel KcsA-Fab complex in high concentration of Tl+
Deposited on 2003-10-02, released 2003-11-25
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r3jA (A:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r3jB (B:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r3jC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3jC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh