PDB entry 1r3f

View 1r3f on RCSB PDB site
Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit
Deposited on 2003-10-01, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.228
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r3fA (A:)
    msrprrrgrdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclg
    eatkfsqylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdie
    qipsmysalkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyi
    rtiiddlgeklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpl
    lmpmdspasdypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeidde
    grvaprrlvveypa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3fA (A:)
    grdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsq
    ylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipitvy
    ellfirhegneleleihcskgtyirtiiddlgeklgcgahviylrrlavskypvermvtl
    ehlrelveqaeqqdipaaelldpllmpmdspasdypvvnlpltssvyfkngnpvrtsgap
    leglvrvtegengkfigmgeiddegrvaprrlvveypa