PDB entry 1r3b

View 1r3b on RCSB PDB site
Description: Solution structure of xenopus laevis Mob1
Class: cell cycle
Keywords: left-handed four-helix bundle, CELL CYCLE
Deposited on 2003-10-01, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mob1
    Species: Xenopus laevis [TaxId:8355]
    Gene: MOB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7T1M9 (19-201)
      • cloning artifact (0-3)
      • expression tag (4-9)
      • cloning artifact (10-12)
      • cloning artifact (14-18)
    Domains in SCOPe 2.08: d1r3ba1, d1r3ba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r3bA (A:)
    mgsshhhhhhssglvprgsatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygt
    itefctestcsvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfps
    kigvpfpknfmsvaktilkrlfrvyahiyhqhfdavmqlqeeahlntsfkhfiffvqefn
    lidrrelaplqelieklgskdr