PDB entry 1r38

View 1r38 on RCSB PDB site
Description: Crystal structure of H114A mutant of Candida tenuis xylose reductase
Class: oxidoreductase
Keywords: Aldo-keto reductase, beta-alpha barrel,dimer, OXIDOREDUCTASE
Deposited on 2003-09-30, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (113)
    Domains in SCOPe 2.07: d1r38a_
  • Chain 'B':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (113)
    Domains in SCOPe 2.07: d1r38b_
  • Chain 'C':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (113)
    Domains in SCOPe 2.07: d1r38c_
  • Chain 'D':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (113)
    Domains in SCOPe 2.07: d1r38d_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r38A (A:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r38A (A:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r38B (B:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r38B (B:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r38C (C:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r38C (C:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r38D (D:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r38D (D:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlfliafpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv