PDB entry 1r37

View 1r37 on RCSB PDB site
Description: Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(H) and 2-ethoxyethanol
Class: oxidoreductase
Keywords: archaeon, zinc, NAD(H) dependent, holoform, OXIDOREDUCTASE
Deposited on 2003-09-30, released 2004-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH OR SSO2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r37a1, d1r37a2
  • Chain 'B':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH OR SSO2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r37b1, d1r37b2
  • Heterogens: ZN, NAD, ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r37A (A:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnnsektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r37B (B:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnnsektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip