PDB entry 1r36

View 1r36 on RCSB PDB site
Description: NMR-based structure of autoinhibited murine Ets-1 deltaN301
Class: transcription
Keywords: transcription factor; autoinhibition module; winged helix-turn-helix; helical bundle
Deposited on 2003-09-30, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-ets-1 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27577 (0-139)
      • engineered (115)
    Domains in SCOPe 2.06: d1r36a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r36A (A:)
    kgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdg
    wefklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvsdlqs
    llgytpeelhamldvkpdad