PDB entry 1r31

View 1r31 on RCSB PDB site
Description: HMG-CoA reductase from Pseudomonas mevalonii complexed with HMG-CoA
Deposited on 2003-09-30, released 2003-10-14
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r31A (A:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r31A (A:)
    ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
    avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiq
    dplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvr
    damgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsge
    aviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghyg
    slttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgl
    aqnlgamralategiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r31B (B:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r31B (B:)
    ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
    avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiq
    dplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvr
    damgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsge
    aviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghyg
    slttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgl
    aqnlgamralategi