PDB entry 1r30

View 1r30 on RCSB PDB site
Description: The Crystal Structure of Biotin Synthase, an S-Adenosylmethionine-Dependent Radical Enzyme
Class: transferase
Keywords: SAM Radical protein, TIM barrel, FeS cluster, TRANSFERASE
Deposited on 2003-09-30, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biotin synthase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r30a_
  • Chain 'B':
    Compound: Biotin synthase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r30b_
  • Heterogens: SAM, SF4, FES, DTB, TRS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r30A (A:)
    gsshhhhhhdydipttenlyfqgsahrprwtlsqvtelfekplldllfeaqqvhrqhfdp
    rqvqvstllsiktgacpedckycpqssryktgleaerlmeveqvlesarkakaagstrfc
    mgaawknpherdmpyleqmvqgvkamgleacmtlgtlsesqaqrlanagldyynhnldts
    pefygniittrtyqerldtlekvrdagikvcsggivglgetvkdraglllqlanlptppe
    svpinmlvkvkgtpladnddvdafdfirtiavarimmptsyvrlsagreqmneqtqamcf
    magansifygckllttpnpeedkdlqlfrklglnpqqtavlagdneqqqrleqalmtpdt
    deyynaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r30A (A:)
    rprwtlsqvtelfekplldllfeaqqvhrqhfdprqvqvstllsiktgacpedckycpqs
    sryktgleaerlmeveqvlesarkakaagstrfcmgaawknpherdmpyleqmvqgvkam
    gleacmtlgtlsesqaqrlanagldyynhnldtspefygniittrtyqerldtlekvrda
    gikvcsggivglgetvkdraglllqlanlptppesvpinmlvkvkgtpladnddvdafdf
    irtiavarimmptsyvrlsagreqmneqtqamcfmagansifygckllttpnpeedkdlq
    lfrklglnpqqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r30B (B:)
    gsshhhhhhdydipttenlyfqgsahrprwtlsqvtelfekplldllfeaqqvhrqhfdp
    rqvqvstllsiktgacpedckycpqssryktgleaerlmeveqvlesarkakaagstrfc
    mgaawknpherdmpyleqmvqgvkamgleacmtlgtlsesqaqrlanagldyynhnldts
    pefygniittrtyqerldtlekvrdagikvcsggivglgetvkdraglllqlanlptppe
    svpinmlvkvkgtpladnddvdafdfirtiavarimmptsyvrlsagreqmneqtqamcf
    magansifygckllttpnpeedkdlqlfrklglnpqqtavlagdneqqqrleqalmtpdt
    deyynaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r30B (B:)
    hrprwtlsqvtelfekplldllfeaqqvhrqhfdprqvqvstllsiktgacpedckycpq
    ssryktgleaerlmeveqvlesarkakaagstrfcmgaawknpherdmpyleqmvqgvka
    mgleacmtlgtlsesqaqrlanagldyynhnldtspefygniittrtyqerldtlekvrd
    agikvcsggivglgetvkdraglllqlanlptppesvpinmlvkvkgtpladnddvdafd
    firtiavarimmptsyvrlsagreqmneqtqamcfmagansifygckllttpnpeedkdl
    qlfrklglnpqqt